PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC055222.270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GATA
Protein Properties Length: 297aa    MW: 32836.2 Da    PI: 4.9654
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC055222.270genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.31e-18211244134
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                    Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
  EcC055222.270 211 CSHCHVQKTPQWRAGPLGLKTLCNACGVRYKSGR 244
                    *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.2E-691295IPR016679Transcription factor, GATA, plant
SMARTSM004011.2E-13205255IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.75E-14206267No hitNo description
Gene3DG3DSA:3.30.50.101.0E-14209242IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.292209241IPR000679Zinc finger, GATA-type
CDDcd002022.94E-13210259No hitNo description
PROSITE patternPS003440211236IPR000679Zinc finger, GATA-type
PfamPF003202.4E-16211244IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005992Biological Processtrehalose biosynthetic process
GO:0006096Biological Processglycolytic process
GO:0006511Biological Processubiquitin-dependent protein catabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0055085Biological Processtransmembrane transport
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004332Molecular Functionfructose-bisphosphate aldolase activity
GO:0004553Molecular Functionhydrolase activity, hydrolyzing O-glycosyl compounds
GO:0008270Molecular Functionzinc ion binding
GO:0022857Molecular Functiontransmembrane transporter activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
GO:0050662Molecular Functioncoenzyme binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
WFDFSNEDGE VEEEEEGGGG GGDEEDDGAE VPKDSSLSDS SQAGDDDCSN LSSSPSASSE  60
PILTSELTVP DDDDIAELEW LSQFVDDDSL PEFPTCYLPG KWEQESSAKN RSEPEPRSVL  120
IRPLCFPSPV PVKTRTKRTR HAKKDQPPSS ESSSTSSCSS ENSSSSCLSF TSVLTSMEFV  180
RSQSEPEKKK KMKKTREPPV QDGPVQFQRR CSHCHVQKTP QWRAGPLGLK TLCNACGVRY  240
KSGRLFPEYR PACSPTFSVE AHSNSHRKVL EMRKRKEMAG NGIEGGRLKL NRMVTSF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010066212.11e-162PREDICTED: GATA transcription factor 6-like
TrEMBLA0A059BCW51e-162A0A059BCW5_EUCGR; Uncharacterized protein
STRINGPOPTR_0009s12620.17e-64(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.25e-40GATA transcription factor 5